PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016496045.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 719aa    MW: 80016.3 Da    PI: 4.4471
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016496045.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding408.9e-13567608346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW+++E el+++av+q+G++  ++I + ++ gRt+ q+k+++ k
   XP_016496045.1 567 RWSKQETELFYEAVQQFGTD-LSLIQQLFP-GRTRRQLKLKYKK 608
                      9*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.0E-28558642No hitNo description
PROSITE profilePS5129311.203563611IPR017884SANT domain
SMARTSM007173.1E-10564612IPR001005SANT/Myb domain
SuperFamilySSF466898.97E-11566615IPR009057Homeodomain-like
CDDcd001672.59E-8567608No hitNo description
Gene3DG3DSA:1.10.10.606.4E-8567608IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 719 aa     Download sequence    Send to blast
MDLLDDILAD GASKTVKAGG KFQPRAKPRL VKKGPAVASS TVSLTSKPTG DTVATDSFEA  60
LKKDGKNSQN YDKQSSVLAE PSLEHPLAAE TLGPSVGSYL DTSMVVPDNS EDSKTCLEKS  120
EGEYADIYIG LDSFDDLLPI SSAIENSSPA TDPSAVHVAG ADKGQEQLSI PVSSVDDSAP  180
STSNLQPDEV AACQDPLTCQ GSVVPEMDSY PSLEADILGV TTTSGQSTRR FQPKSKLQVY  240
RERYDTSIPD SDAVESVSCQ PNSHSVHSEM DFVDREKEHG FPADDVLDFS ARGFDNNIIT  300
ESTHEFPVHE EYVIEASHSD VGIPAELPES TSQMPEEPVH QRPKTKKQKL PASDLSAITE  360
ENGAGRSLRS RRKSVNANRL VDESEVVADD GEYVPEQPND SVTNGNDEDL LVENESQGKK  420
VQKKSKRTVA EDRKQVRKSK KTTEASDQAA NKKPKKFSHS TRQKRRQVNK ALLEAPEYEI  480
DYQKVPIKDL IILGEHRERL AKKDAAASQI PTTDQSAGAS VSNYNEDETY PSDDGAEDND  540
HQIGSRAQDS SAYFNYQTYM DKTPSTRWSK QETELFYEAV QQFGTDLSLI QQLFPGRTRR  600
QLKLKYKKEE RQHPFRLHDA LTNRSKDHSH FERVIERLKQ IEAEELQKAD KDESTDLTGE  660
EEVEEGTQEI NEEEANSEHV EEKEVEAVEQ QDVPEMESPV EDYDSEDDSW RWSQYKSEV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1421440QKKSKRTVAEDRKQVRKSKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0488871e-96GU048887.1 Capsicum annuum clone BAC CaCM511O09_Contig, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016496045.10.0PREDICTED: transcription factor TFIIIB component B'' homolog
TrEMBLM1BI380.0M1BI38_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000457280.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59022326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.17e-51MYB_related family protein